PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622771.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 231aa    MW: 26618.1 Da    PI: 8.9996
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622771.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.37.2e-082464341
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqck 41
                      WT+eE +++  a + +  +   +W+ +a++++ g+++ ++ 
   XP_009622771.1 24 EWTKEENKKFESALAIYDEKtpnRWSMVAAMIP-GKSALDVM 64
                     7********************************.***98875 PP

2Myb_DNA-binding41.62.8e-13121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + +++G+g+W+ I+r +   +t+ q+ s+ qky
   XP_009622771.1 121 PWTEEEHRRFLMGLEKYGKGDWRNISRNFVISKTPTQVASHAQKY 165
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-41569IPR009057Homeodomain-like
PROSITE profilePS500906.8531771IPR017877Myb-like domain
SuperFamilySSF466891.52E-111971IPR009057Homeodomain-like
SMARTSM007174.8E-102173IPR001005SANT/Myb domain
CDDcd001672.52E-72471No hitNo description
PfamPF002493.6E-62467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-12111169IPR009057Homeodomain-like
PROSITE profilePS5129419.357114170IPR017930Myb domain
SuperFamilySSF466891.5E-16115169IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-18117169IPR006447Myb domain, plants
SMARTSM007171.2E-11118168IPR001005SANT/Myb domain
PfamPF002491.8E-11121165IPR001005SANT/Myb domain
CDDcd001673.63E-9121165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
METLFPTAFI PNSNWILQHS KSTEWTKEEN KKFESALAIY DEKTPNRWSM VAAMIPGKSA  60
LDVMMQYKEL VADVSDIEAG LVPTPRNFDS AFTLEFVDHR EIHTFRKRGK SCDQERKKGV  120
PWTEEEHRRF LMGLEKYGKG DWRNISRNFV ISKTPTQVAS HAQKYYLRQL SGGKDKKRAS  180
IHDITTVHLT DDELLNNNNN NNNNNKKSMC EEKYSMSPLQ KLTSTGDVVI A
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105117RKRGKSCDQERKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622771.11e-176PREDICTED: transcription factor DIVARICATA-like
RefseqXP_009622772.11e-176PREDICTED: transcription factor DIVARICATA-like
RefseqXP_009622774.11e-176PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-84DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0V0I0R11e-125A0A0V0I0R1_SOLCH; Putative transcription factor DIVARICATA-like
STRINGPGSC0003DMT4000697531e-124(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-85MYB family protein